anti MOG / Myelin oligodendroc...
- Article
- anti MOG / Myelin oligodendrocyte glycoprotein antibody
- Product Number
- ARG41772-50UG
- Supplier
- Arigo Biolaboratories
- Size
- 50 ug
- Description
- The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
- Category
- Antibodies
- Product Group
- Polyclonal Antibodies
- Application
- FC, IHC-P, WB
- Host
- Rabbit
- Species reactivity
- Human, Mouse, Rat
- Conjugate
- Unconjugated
- Formulation
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
- Immunogen
- Synthetic peptide corresponding to a sequence of Human MOG / Myelin oligodendrocyte glycoprotein. (RVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGK)
- Synonyms
- BTN6; BTNL11; MOG alpha-5; MOG AluA; MOG AluB; MOG Ig-AluB; MOGIG2; myelin-oligodendrocyte glycoprotein; NRCLP7
- Unigene ID
- 4340
- Gene Symbols
- MOG
- Shipping Temperature
- BLUE ICE
- Supplier URL
- Visit supplier product page
Size: 50 ug
479.00 CHF