Frizzled 4 antibody
- Article
- Frizzled 4 antibody
- Product Number
- GTX01572-100UL
- Supplier
- GeneTex
- Size
- 100 ul
- Description
- This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. [provided by RefSeq, Jul 2008]
- Category
- Antibodies
- Product Group
- Polyclonal Antibodies
- Application
- IHC-P, WB
- Host
- Rabbit
- Species reactivity
- Human
- Conjugate
- Unconjugated
- Formulation
- PBS, 2% Sucrose, 0.09% Sodium azide.
- Immunogen
- The immunogen is a synthetic peptide directed towards the middle region of human FZD4. Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV.
- Synonyms
- CD344; EVR1; FEVR; frizzled 4, seven transmembrane spanning receptor; frizzled family receptor 4; frizzled homolog 4; frizzled-4; Fz4; Fz-4; FZD4S; FzE4; GPCR; hFz4; WNT receptor frizzled-4
- Unigene ID
- 8322
- Gene Symbols
- FZD4
- Shipping Temperature
- BLUE ICE
- Supplier URL
- Visit supplier product page
Size: 100 ul
593.00 CHF