ACTH (7-38), human / Corticotr...
- Article
- ACTH (7-38), human / Corticotropin Inhibiting Peptide (7-38), human
- Product Number
- 111-45-1MG
- Supplier
- Echelon Biosciences
- Size
- 1 mg
- Description
- CAS Number: 68563-24-6 \nMolecular Weight: 3656.92 \nSalt Form: TFA \nPurity: >96% \nSequence (3-letter): Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH \nSequence (1-letter): FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE-OH \nStorage: -20 ?C or below \n \nACTH (7-38) or Corticotropin Inhibiting Peptide (CIP) (7-38) is a fragment of Adrenocorticotropic Hormone which inhibits ACTH stimulated adenylate cyclase. It can acts as an antagonist of ACTH receptors.
- Category
- Proteins, Peptides and Small Molecules
- Product Group
- Peptides
- CAS Number
- 68563-24-6
- Molecular Weight
- 3656.92
- Shipping Temperature
- RT
