ACTH (7-38) human / Corticotro...
- Article
- ACTH (7-38) human / Corticotropin Inhibiting Peptide (7-38) human
- Product Number
- 111-45-1MG
- Supplier
- Echelon Biosciences
- Size
- 1 mg
- Description
- CAS Number: 68563-24-6Molecular Weight: 3656.92Salt Form: TFAPurity: >96%Sequence (3-letter): Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OHSequence (1-letter): FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE-OHStorage: -20 °C or belowACTH (7-38) or Corticotropin Inhibiting Peptide (CIP) (7-38) is a fragment of Adrenocorticotropic Hormone which inhibits ACTH stimulated adenylate cyclase. It can acts as an antagonist of ACTH receptors.
- Category
- Proteins, Peptides and Small Molecules
- Product Group
- Peptides
- Shipping Temperature
- RT
- Supplier URL
- Visit supplier product page
