Calcitonin, salmon (cyclic)
- Article
- Calcitonin, salmon (cyclic)
- Product Number
- 237-26-5MG
- Supplier
- Echelon Biosciences
- Size
- 5 mg
- Description
- CAS Number: 47931-85-1Molecular Weight: 3431.74Salt Form: AcetatePurity: >96%Sequence (3-letter): Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Cys1-Cys7)Sequence (1-letter): CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2Storage: -20 °C or belowSolubility: 1% acetic acid to 1 mg/mLCalcitonin is cyclic peptide hormone that stimulates bone formation by osteoblasts and inhibits bone resorption. Calcitonin is a hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of non-mammalian vertebrates. It decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. Salmon calcitonin is more potent than mammalian forms.References1.Chestnut C.H. et al. (2000) aoeA randomized trial of nasal spray salmon calcitonin in postmenopausal women with established osteoporosis: the prevent recurrence of osteoporotic fractures studya Am. J. Med. 109 (4): 267-276.2.Manicourt D.-H. et al. (2006) aoeOral salmon calcitonin reduces Lequesne's algofunctional index scores and decreases urinary and serum levels of biomarkers of joint metabolism in knee osteoarthritisa Arthritis Rheum. 54 (10): 3205-3211.
- Category
- Proteins, Peptides and Small Molecules
- Product Group
- Peptides
- Molecular Weight
- 3431.74
- Shipping Temperature
- RT
- Supplier URL
- Visit supplier product page