Mouse TNF alpha Recombinant Pr...
- Article
- Mouse TNF alpha Recombinant Protein
- Product Number
- RP0374M-100
- Supplier
- Kingfisher Biotech
- Size
- 100 ug
- Description
- The Mouse TNF alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse TNF alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse TNF alpha yeast-derived recombinant protein can be purchased in multiple sizes. Mouse TNF alpha Specifications: (Molecular Weight: 17.3 kDa) (Amino Acid Sequence: LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156)) (Gene ID: 21926). For research use only.
- Category
- Proteins, Peptides and Small Molecules
- Product Group
- Growth Factors, Chemokines & Cytokines
- Application
- ELISA, ELISPOT, TC, WB
- Species reactivity
- Mouse
- Purity
- >98% as visualized by SDS-PAGE analysis.
- Immunogen
- TNF alpha
- Molecular Weight
- 17.3 kDa
- Shipping Temperature
- RT
- Estimated Delivery Time:
- 5 Business Days
- Supplier URL
- Visit supplier product page